Lineage for d1em1b2 (1em1 B:84-198)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722119Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 722120Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 722121Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 722247Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)
  7. 722300Species Human (Homo sapiens) [TaxId:9606] [54724] (23 PDB entries)
  8. 722338Domain d1em1b2: 1em1 B:84-198 [38712]
    Other proteins in same PDB: d1em1a1, d1em1b1
    complexed with mw1, so4; mutant

Details for d1em1b2

PDB Entry: 1em1 (more details), 2.13 Å

PDB Description: x-ray crystal structure for human manganese superoxide dismutase, q143a
PDB Compounds: (B:) manganese superoxide dismutase

SCOP Domain Sequences for d1em1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1em1b2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpna
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d1em1b2:

Click to download the PDB-style file with coordinates for d1em1b2.
(The format of our PDB-style files is described here.)

Timeline for d1em1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1em1b1