![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) ![]() |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [54721] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54724] (8 PDB entries) |
![]() | Domain d1em1b2: 1em1 B:84-198 [38712] Other proteins in same PDB: d1em1a1, d1em1b1 |
PDB Entry: 1em1 (more details), 2.13 Å
SCOP Domain Sequences for d1em1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1em1b2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)} ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpna dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk
Timeline for d1em1b2: