SCOPe 2.07: Domain d6jz7b2: 6jz7 B:186-278

Lineage for d6jz7b2 (6jz7 B:186-278)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families)

5. Family b.1.4.0: automated matches [254272] (1 protein)
   not a true family

6. Protein automated matches [254633] (16 species)
   not a true protein

7. Species Ruminococcus gnavus [TaxId:33038] [361247] (8 PDB entries)

8. Domain d6jz7b2: 6jz7 B:186-278 [387119]
   Other proteins in same PDB: d6jz7a1, d6jz7a3, d6jz7b1, d6jz7b3
   automated match to d5c71a2
   complexed with cku

Details for d6jz7b2

PDB Entry: 6jz7, 1.45 Å

PDB Description: b-glucuronidase from ruminococcus gnavus in complex with n1- substituted uronic isofagomine

PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d6jz7b2:

Sequence; same for both SEQRES and ATOM records:

>d6jz7b2 b.1.4.0 (B:186-278) automated matches {Ruminococcus gnavus [TaxId: 33038]}
esvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqvanarl
wevrnaylyqivilitdgngvldeyrekigirt

Timeline for d6jz7b2:

• d6jz7b2 is new in SCOPe 2.07-stable
  
• d6jz7b2 appears in the current release, SCOPe 2.08