![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
![]() | Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) ![]() |
![]() | Family d.120.1.0: automated matches [191500] (1 protein) not a true family |
![]() | Protein automated matches [190822] (5 species) not a true protein |
![]() | Species Ramazzottius varieornatus [TaxId:947166] [387113] (1 PDB entry) |
![]() | Domain d7bwha_: 7bwh A: [387114] automated match to d2i89a_ complexed with cl, hem |
PDB Entry: 7bwh (more details), 1.4 Å
SCOPe Domain Sequences for d7bwha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bwha_ d.120.1.0 (A:) automated matches {Ramazzottius varieornatus [TaxId: 947166]} eeqtfswseisqhtsanslwvvvrdktspgsplrvydvtnfqkthpgghlillkyagtec srafaavghskyaikrmsqyrigiaead
Timeline for d7bwha_: