Lineage for d6xvwa2 (6xvw A:797-1011)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000733Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 3000734Protein automated matches [191197] (13 species)
    not a true protein
  7. 3000809Species Human (Homo sapiens) [TaxId:9606] [225406] (56 PDB entries)
  8. 3000845Domain d6xvwa2: 6xvw A:797-1011 [387108]
    Other proteins in same PDB: d6xvwa1, d6xvwa3, d6xvwb1, d6xvwb3
    automated match to d4hhyd2
    protein/DNA complex; complexed with edo, ni, o3h

Details for d6xvwa2

PDB Entry: 6xvw (more details), 2 Å

PDB Description: catalytic domain of human parp-1 in complex with the inhibitor mc2050
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d6xvwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xvwa2 d.166.1.0 (A:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d6xvwa2:

Click to download the PDB-style file with coordinates for d6xvwa2.
(The format of our PDB-style files is described here.)

Timeline for d6xvwa2: