Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225406] (56 PDB entries) |
Domain d6xvwa2: 6xvw A:797-1011 [387108] Other proteins in same PDB: d6xvwa1, d6xvwa3, d6xvwb1, d6xvwb3 automated match to d4hhyd2 protein/DNA complex; complexed with edo, ni, o3h |
PDB Entry: 6xvw (more details), 2 Å
SCOPe Domain Sequences for d6xvwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xvwa2 d.166.1.0 (A:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]} lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis sgvndtsllyneyivydiaqvnlkyllklkfnfkt
Timeline for d6xvwa2: