Lineage for d1ap5b2 (1ap5 B:84-198)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2552895Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2553021Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2553085Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries)
  8. 2553151Domain d1ap5b2: 1ap5 B:84-198 [38710]
    Other proteins in same PDB: d1ap5a1, d1ap5b1
    complexed with mn; mutant

Details for d1ap5b2

PDB Entry: 1ap5 (more details), 2.2 Å

PDB Description: tyr34->phe mutant of human mitochondrial manganese superoxide dismutase
PDB Compounds: (B:) manganese superoxide dismutase

SCOPe Domain Sequences for d1ap5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap5b2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOPe Domain Coordinates for d1ap5b2:

Click to download the PDB-style file with coordinates for d1ap5b2.
(The format of our PDB-style files is described here.)

Timeline for d1ap5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ap5b1