Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
Protein Mn superoxide dismutase (MnSOD) [54721] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54724] (8 PDB entries) |
Domain d1abmb2: 1abm B:84-198 [38708] Other proteins in same PDB: d1abma1, d1abmb1 |
PDB Entry: 1abm (more details), 2.2 Å
SCOP Domain Sequences for d1abmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1abmb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)} ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk
Timeline for d1abmb2: