Lineage for d1abmb2 (1abm B:84-198)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79570Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 79571Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 79572Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 79623Protein Mn superoxide dismutase (MnSOD) [54721] (3 species)
  7. 79653Species Human (Homo sapiens) [TaxId:9606] [54724] (8 PDB entries)
  8. 79657Domain d1abmb2: 1abm B:84-198 [38708]
    Other proteins in same PDB: d1abma1, d1abmb1

Details for d1abmb2

PDB Entry: 1abm (more details), 2.2 Å

PDB Description: the structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles

SCOP Domain Sequences for d1abmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abmb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d1abmb2:

Click to download the PDB-style file with coordinates for d1abmb2.
(The format of our PDB-style files is described here.)

Timeline for d1abmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1abmb1