Lineage for d6xvwb2 (6xvw B:797-1011)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606665Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2606666Protein automated matches [191197] (12 species)
    not a true protein
  7. 2606733Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries)
  8. 2606772Domain d6xvwb2: 6xvw B:797-1011 [387079]
    Other proteins in same PDB: d6xvwa1, d6xvwa3, d6xvwb1, d6xvwb3
    automated match to d4hhyd2
    protein/DNA complex; complexed with edo, ni, o3h

Details for d6xvwb2

PDB Entry: 6xvw (more details), 2 Å

PDB Description: catalytic domain of human parp-1 in complex with the inhibitor mc2050
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d6xvwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xvwb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d6xvwb2:

Click to download the PDB-style file with coordinates for d6xvwb2.
(The format of our PDB-style files is described here.)

Timeline for d6xvwb2: