Lineage for d6xvwb1 (6xvw B:663-796)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321349Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2321350Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2321375Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2321376Protein automated matches [226964] (2 species)
    not a true protein
  7. 2321377Species Human (Homo sapiens) [TaxId:9606] [225405] (57 PDB entries)
  8. 3087016Domain d6xvwb1: 6xvw B:663-796 [387078]
    Other proteins in same PDB: d6xvwa2, d6xvwa3, d6xvwb2, d6xvwb3
    automated match to d4hhyd1
    protein/DNA complex; complexed with edo, ni, o3h

Details for d6xvwb1

PDB Entry: 6xvw (more details), 2 Å

PDB Description: catalytic domain of human parp-1 in complex with the inhibitor mc2050
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d6xvwb1:

Sequence, based on SEQRES records: (download)

>d6xvwb1 a.41.1.0 (B:663-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavsq
gssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrggs
ddsskdpidvnyek

Sequence, based on observed residues (ATOM records): (download)

>d6xvwb1 a.41.1.0 (B:663-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavsq
gssdsqildlsnrfytliphdfpllnnadsvqakvemldnlldievaysllrggsddssk
dpidvnyek

SCOPe Domain Coordinates for d6xvwb1:

Click to download the PDB-style file with coordinates for d6xvwb1.
(The format of our PDB-style files is described here.)

Timeline for d6xvwb1:

  • d6xvwb1 is new in SCOPe 2.07-stable