Lineage for d6yk3a1 (6yk3 A:3-263)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521242Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2521254Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)
  8. 2521256Domain d6yk3a1: 6yk3 A:3-263 [387071]
    Other proteins in same PDB: d6yk3a2
    automated match to d4h8ja_
    complexed with cl, gol, nh4, pvq, so4

Details for d6yk3a1

PDB Entry: 6yk3 (more details), 1.2 Å

PDB Description: structure of the ampa receptor glua2o ligand-binding domain (s1s2j) in complex with the compound ( s) - 1- [2'-amino-2'-carboxyethyl]-5 ,7- dihydropyrrolo[3,4-d]pyrimidin-2,4(1h,3h)-dione at resolution 1.20a
PDB Compounds: (A:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d6yk3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yk3a1 c.94.1.1 (A:3-263) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecgs

SCOPe Domain Coordinates for d6yk3a1:

Click to download the PDB-style file with coordinates for d6yk3a1.
(The format of our PDB-style files is described here.)

Timeline for d6yk3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6yk3a2