Lineage for d1ap6b2 (1ap6 B:84-198)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411078Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 411079Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 411080Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 411184Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)
  7. 411228Species Human (Homo sapiens) [TaxId:9606] [54724] (14 PDB entries)
  8. 411236Domain d1ap6b2: 1ap6 B:84-198 [38706]
    Other proteins in same PDB: d1ap6a1, d1ap6b1
    complexed with mn; mutant

Details for d1ap6b2

PDB Entry: 1ap6 (more details), 1.9 Å

PDB Description: tyr34->phe mutant of human mitochondrial manganese superoxide dismutase

SCOP Domain Sequences for d1ap6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap6b2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d1ap6b2:

Click to download the PDB-style file with coordinates for d1ap6b2.
(The format of our PDB-style files is described here.)

Timeline for d1ap6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ap6b1