Lineage for d6tghc_ (6tgh C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896366Protein automated matches [190152] (25 species)
    not a true protein
  7. 2896466Species Streptococcus thermophilus [TaxId:299768] [270038] (8 PDB entries)
  8. 2896482Domain d6tghc_: 6tgh C: [387056]
    automated match to d4wxga_
    complexed with dsn, evm, na, plp

Details for d6tghc_

PDB Entry: 6tgh (more details), 2.12 Å

PDB Description: shmt from streptococcus thermophilus tyr55thr variant in complex with d-serine both as external aldimine and as non-covalent complex
PDB Compounds: (C:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d6tghc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tghc_ c.67.1.4 (C:) automated matches {Streptococcus thermophilus [TaxId: 299768]}
dykafdpelwnaidaeaerqqnnieliasenvvskavmaaqgtlltnktaegypgkryyg
gtavidvvetlaierakklfgakfanvqphsgsqanaavymsliqpgdtvmgmdlsaggh
lthgapvsfsgktynfvsynvdkeselldydailaqakevrpklivagasaysriidfak
freiadavgaylmvdmahiaglvasghhpspvpyahvttttthktlrgprggliltdded
iakklnsavfpglqggplehviaakavalkealdpafkeygenviknaaamadvfnqhpd
frvisggtnnhlflvdvtkvvengkvaqnvleevnitlnknsipyeqlspfktsgirvgs
paitsrgmgeaesrqiaewmvealenhdkpevlerirgdvkvltdafply

SCOPe Domain Coordinates for d6tghc_:

Click to download the PDB-style file with coordinates for d6tghc_.
(The format of our PDB-style files is described here.)

Timeline for d6tghc_: