SCOP 1.71: Domain d1ap6a2: 1ap6 A:84-198

Lineage for d1ap6a2 (1ap6 A:84-198)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (14 PDB entries)

8. Domain d1ap6a2: 1ap6 A:84-198 [38705]
   Other proteins in same PDB: d1ap6a1, d1ap6b1

Details for d1ap6a2

PDB Entry: 1ap6, 1.9 Å

PDB Description: tyr34->phe mutant of human mitochondrial manganese superoxide dismutase

SCOP Domain Sequences for d1ap6a2:

Sequence; same for both SEQRES and ATOM records:

>d1ap6a2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d1ap6a2:

• d1ap6a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ap6a2 appears in SCOP 1.69
  
• d1ap6a2 appears in SCOP 1.73
  
• d1ap6a2 appears in the current release, SCOPe 2.08