![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) ![]() |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [54721] (6 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54723] (2 PDB entries) |
![]() | Domain d3mdsb2: 3mds B:93-203 [38704] Other proteins in same PDB: d3mdsa1, d3mdsb1 |
PDB Entry: 3mds (more details), 1.8 Å
SCOP Domain Sequences for d3mdsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mdsb2 d.44.1.1 (B:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus} ggakepvgelkkaideqfggfqalkekltqaamgrfgsgwawlvkdpfgklhvlstpnqd npvmegftpivgidvwehayylkyqnrradylqaiwnvlnwdvaeeffkka
Timeline for d3mdsb2: