![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families) ![]() Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases |
![]() | Family d.160.1.2: Carbamilase [64433] (3 proteins) |
![]() | Protein Hypothetical protein PH0642 [103323] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [103324] (3 PDB entries) |
![]() | Domain d6ypad1: 6ypa D:1-262 [387039] Other proteins in same PDB: d6ypaa2, d6ypab2, d6ypac2, d6ypad2 automated match to d1j31a_ complexed with gol, p6w |
PDB Entry: 6ypa (more details), 1.58 Å
SCOPe Domain Sequences for d6ypad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ypad1 d.160.1.2 (D:1-262) Hypothetical protein PH0642 {Pyrococcus horikoshii [TaxId: 53953]} mvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfdva qqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfyre kvffepgdlgfkvfdigfakvgvmiafdwffpesartlalkgaeiiahpanlvmpyapra mpiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidlnla rnkrlndmndifkdrreeyyfr
Timeline for d6ypad1: