Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.29: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345916] (1 family) C-terminal part of Pfam PF05282 Structural similarity with VHS domains (48464) noted in PubMed 21764848, but no compelling evidence of homology |
Family a.118.29.1: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345957] (2 proteins) |
Protein U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain [346042] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346205] (140 PDB entries) |
Domain d5r1sb2: 5r1s B:170-317 [386975] Other proteins in same PDB: d5r1sa1, d5r1sa2, d5r1sb1 automated match to d3sbtb2 |
PDB Entry: 5r1s (more details), 2.05 Å
SCOPe Domain Sequences for d5r1sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5r1sb2 a.118.29.1 (B:170-317) U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} sdpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgelqfafl namffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillnervw niclyssfqknslhntekimenkypell
Timeline for d5r1sb2: