Lineage for d6sp1b_ (6sp1 B:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.11: Kelch motif [117281] (2 families) 
Family b.68.11.1: Kelch motif [117282] (2 proteins)
Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
Protein automated matches [190126] (2 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [193097] (25 PDB entries) 
Domain d6sp1b_: 6sp1 B: [386961]
automated match to d4in4c_
complexed with act, lq8
Details for d6sp1b_
PDB Entry: 6sp1 (more details), 2.57 Å
PDB Description: keap1 in complex with compound 6
PDB Compounds: (B:) Kelch-like ECH-associated protein 1SCOPe Domain Sequences for d6sp1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sp1b_ b.68.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnsp
dgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsverye
perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamn
tirsgagvcvlhnciyaaggydgqdqlnsverydvatatwtfvapmkhrrsalgitvhqg
riyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
SCOPe Domain Coordinates for d6sp1b_:
Click to download the PDB-style file with coordinates for d6sp1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6sp1b_:
- d6sp1b_ is new in SCOPe 2.07-stable
- d6sp1b_ appears in the current release, SCOPe 2.08
View in 3D
