Class b: All beta proteins [48724] (178 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.11: Kelch motif [117281] (2 families) |
Family b.68.11.1: Kelch motif [117282] (2 proteins) Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967) |
Protein automated matches [190126] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193097] (25 PDB entries) |
Domain d6sp1b_: 6sp1 B: [386961] automated match to d4in4c_ complexed with act, lq8 |
PDB Entry: 6sp1 (more details), 2.57 Å
SCOPe Domain Sequences for d6sp1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sp1b_ b.68.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} grliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnsp dgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsverye perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamn tirsgagvcvlhnciyaaggydgqdqlnsverydvatatwtfvapmkhrrsalgitvhqg riyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
Timeline for d6sp1b_: