Lineage for d1i08b2 (1i08 B:91-205)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31967Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 31968Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 31969Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 32020Protein Mn superoxide dismutase (MnSOD) [54721] (3 species)
  7. 32021Species Escherichia coli [TaxId:562] [54722] (5 PDB entries)
  8. 32033Domain d1i08b2: 1i08 B:91-205 [38696]
    Other proteins in same PDB: d1i08a1, d1i08b1, d1i08c1, d1i08d1

Details for d1i08b2

PDB Entry: 1i08 (more details), 2.2 Å

PDB Description: crystal structure analysis of the h30a mutant of manganese superoxide dismutase from e. coli

SCOP Domain Sequences for d1i08b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i08b2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOP Domain Coordinates for d1i08b2:

Click to download the PDB-style file with coordinates for d1i08b2.
(The format of our PDB-style files is described here.)

Timeline for d1i08b2: