![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
![]() | Species Escherichia coli [TaxId:562] [54722] (12 PDB entries) |
![]() | Domain d1i08a2: 1i08 A:91-205 [38695] Other proteins in same PDB: d1i08a1, d1i08b1, d1i08c1, d1i08d1 complexed with mn; mutant |
PDB Entry: 1i08 (more details), 2.2 Å
SCOPe Domain Sequences for d1i08a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i08a2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk
Timeline for d1i08a2: