Lineage for d6sp4c_ (6sp4 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808612Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2808613Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2808622Protein automated matches [190126] (2 species)
    not a true protein
  7. 2808623Species Human (Homo sapiens) [TaxId:9606] [193097] (24 PDB entries)
  8. 2808670Domain d6sp4c_: 6sp4 C: [386941]
    automated match to d4in4c_
    complexed with lqk

Details for d6sp4c_

PDB Entry: 6sp4 (more details), 2.59 Å

PDB Description: keap1 in complex with compound 23
PDB Compounds: (C:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d6sp4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sp4c_ b.68.11.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnspd
gntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsveryep
erdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamnt
irsgagvcvlhnciyaaggydgqdqlnsverydvatatwtfvapmkhrrsalgitvhqgr
iyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

SCOPe Domain Coordinates for d6sp4c_:

Click to download the PDB-style file with coordinates for d6sp4c_.
(The format of our PDB-style files is described here.)

Timeline for d6sp4c_: