SCOPe 2.08: Domain d1vewa2: 1vew A:91-205

Lineage for d1vewa2 (1vew A:91-205)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Escherichia coli [TaxId:562] [54722] (12 PDB entries)

8. Domain d1vewa2: 1vew A:91-205 [38691]
   Other proteins in same PDB: d1vewa1, d1vewb1, d1vewc1, d1vewd1
   complexed with mn, oh

Details for d1vewa2

PDB Entry: 1vew, 2.1 Å

PDB Description: manganese superoxide dismutase from escherichia coli

PDB Compounds: (A:) manganese superoxide dismutase

SCOPe Domain Sequences for d1vewa2:

Sequence; same for both SEQRES and ATOM records:

>d1vewa2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

Timeline for d1vewa2:

• d1vewa2 first appeared (with stable ids) in SCOP 1.55
  
• d1vewa2 appears in SCOPe 2.07