Lineage for d6ra9a3 (6ra9 A:337-454)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793974Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2793975Protein automated matches [254425] (18 species)
    not a true protein
  7. 2794031Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [259164] (2 PDB entries)
  8. 2794032Domain d6ra9a3: 6ra9 A:337-454 [386889]
    Other proteins in same PDB: d6ra9a1, d6ra9a2, d6ra9b1, d6ra9b2
    automated match to d4c0sa3
    complexed with gdp, gol, gpe, pok, so4

Details for d6ra9a3

PDB Entry: 6ra9 (more details), 2.7 Å

PDB Description: novel structural features and post-translational modifications in eukaryotic elongation factor 1a2 from oryctolagus cuniculus
PDB Compounds: (A:) Elongation factor 1-alpha 2

SCOPe Domain Sequences for d6ra9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ra9a3 b.44.1.0 (A:337-454) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aaqftsqviilnhpgqisagyspvidchtahiackfaelkekidrrsgkklednpkslks
gdaaivemvpgkpmcvesfsqypplgrfavrdmrqtvavgviknvekksggagkvtks

SCOPe Domain Coordinates for d6ra9a3:

Click to download the PDB-style file with coordinates for d6ra9a3.
(The format of our PDB-style files is described here.)

Timeline for d6ra9a3: