Class b: All beta proteins [48724] (180 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (18 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [259164] (2 PDB entries) |
Domain d6ra9a3: 6ra9 A:337-454 [386889] Other proteins in same PDB: d6ra9a1, d6ra9a2, d6ra9b1, d6ra9b2 automated match to d4c0sa3 complexed with gdp, gol, gpe, pok, so4 |
PDB Entry: 6ra9 (more details), 2.7 Å
SCOPe Domain Sequences for d6ra9a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ra9a3 b.44.1.0 (A:337-454) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} aaqftsqviilnhpgqisagyspvidchtahiackfaelkekidrrsgkklednpkslks gdaaivemvpgkpmcvesfsqypplgrfavrdmrqtvavgviknvekksggagkvtks
Timeline for d6ra9a3: