| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
| Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
| Species Escherichia coli [TaxId:562] [54722] (12 PDB entries) |
| Domain d1d5nb2: 1d5n B:91-205 [38688] Other proteins in same PDB: d1d5na1, d1d5nb1, d1d5nc1, d1d5nd1 complexed with mn |
PDB Entry: 1d5n (more details), 1.55 Å
SCOPe Domain Sequences for d1d5nb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5nb2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk
Timeline for d1d5nb2: