SCOP 1.75: Domain d1i0hb2: 1i0h B:91-205

Lineage for d1i0hb2 (1i0h B:91-205)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)

7. Species Escherichia coli [TaxId:562] [54722] (11 PDB entries)

8. Domain d1i0hb2: 1i0h B:91-205 [38686]
   Other proteins in same PDB: d1i0ha1, d1i0hb1
   complexed with mw1; mutant

Details for d1i0hb2

PDB Entry: 1i0h, 1.35 Å

PDB Description: crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.

PDB Compounds: (B:) manganese superoxide dismutase y174f mutant

SCOP Domain Sequences for d1i0hb2:

Sequence; same for both SEQRES and ATOM records:

>d1i0hb2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayflkfqnrrpdyikefwnvvnwdeaaarfaakk

Timeline for d1i0hb2:

• d1i0hb2 first appeared (with stable ids) in SCOP 1.55
  
• d1i0hb2 appears in SCOP 1.73
  
• d1i0hb2 appears in SCOPe 2.01
  
• d1i0hb2 appears in the current release, SCOPe 2.08