Lineage for d1i0hb2 (1i0h B:91-205)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31967Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 31968Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 31969Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 32020Protein Mn superoxide dismutase (MnSOD) [54721] (3 species)
  7. 32021Species Escherichia coli [TaxId:562] [54722] (5 PDB entries)
  8. 32023Domain d1i0hb2: 1i0h B:91-205 [38686]
    Other proteins in same PDB: d1i0ha1, d1i0hb1

Details for d1i0hb2

PDB Entry: 1i0h (more details), 1.35 Å

PDB Description: crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.

SCOP Domain Sequences for d1i0hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0hb2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayflkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOP Domain Coordinates for d1i0hb2:

Click to download the PDB-style file with coordinates for d1i0hb2.
(The format of our PDB-style files is described here.)

Timeline for d1i0hb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i0hb1