Lineage for d5r3ua_ (5r3u A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2393721Protein automated matches [190156] (5 species)
    not a true protein
  7. 2393724Species Cryphonectria parasitica [TaxId:5116] [187236] (191 PDB entries)
  8. 3086792Domain d5r3ua_: 5r3u A: [386854]
    automated match to d1oewa_

Details for d5r3ua_

PDB Entry: 5r3u (more details), 1.09 Å

PDB Description: pandda analysis group deposition -- auto-refined data of endothiapepsin for ground state model 54, dmso-free
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d5r3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5r3ua_ b.50.1.2 (A:) automated matches {Cryphonectria parasitica [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d5r3ua_:

Click to download the PDB-style file with coordinates for d5r3ua_.
(The format of our PDB-style files is described here.)

Timeline for d5r3ua_:

  • d5r3ua_ is new in SCOPe 2.07-stable