Class b: All beta proteins [48724] (178 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein automated matches [190156] (5 species) not a true protein |
Species Cryphonectria parasitica [TaxId:5116] [187236] (191 PDB entries) |
Domain d5r2la_: 5r2l A: [386847] automated match to d1oewa_ |
PDB Entry: 5r2l (more details), 1 Å
SCOPe Domain Sequences for d5r2la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5r2la_ b.50.1.2 (A:) automated matches {Cryphonectria parasitica [TaxId: 5116]} stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi ginifgdvalkaafvvfngattptlgfask
Timeline for d5r2la_: