Lineage for d5r2ia_ (5r2i A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. Protein automated matches [190156] (5 species)
    not a true protein
  7. Species Cryphonectria parasitica [TaxId:5116] [187236] (191 PDB entries)
  8. Domain d5r2ia_: 5r2i A: [386831]
    automated match to d1oewa_

Details for d5r2ia_

PDB Entry: 5r2i (more details), 1.01 Å

PDB Description: pandda analysis group deposition -- auto-refined data of endothiapepsin for ground state model 05, dmso-free
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d5r2ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5r2ia_ b.50.1.2 (A:) automated matches {Cryphonectria parasitica [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d5r2ia_ are not available.

Timeline for d5r2ia_: