Lineage for d5rboa_ (5rbo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2802193Protein automated matches [190156] (5 species)
    not a true protein
  7. 2802196Species Cryphonectria parasitica [TaxId:5116] [187236] (191 PDB entries)
  8. 2802327Domain d5rboa_: 5rbo A: [386803]
    automated match to d1oewa_
    complexed with act, dms, gol, pg4, r8a

Details for d5rboa_

PDB Entry: 5rbo (more details), 1.08 Å

PDB Description: pandda analysis group deposition -- endothiapepsin changed state model for fragment f2x-entry library a07a
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d5rboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5rboa_ b.50.1.2 (A:) automated matches {Cryphonectria parasitica [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d5rboa_:

Click to download the PDB-style file with coordinates for d5rboa_.
(The format of our PDB-style files is described here.)

Timeline for d5rboa_: