Lineage for d1tfea_ (1tfe A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189764Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
    beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123
  4. 2189765Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
    comprises two structural repeats of this fold
  5. 2189766Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)
  6. 2189767Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species)
  7. 2189796Species Thermus thermophilus [TaxId:274] [54717] (2 PDB entries)
  8. 2189797Domain d1tfea_: 1tfe A: [38680]
    dimer of a one subdomain fragment

Details for d1tfea_

PDB Entry: 1tfe (more details), 1.7 Å

PDB Description: dimerization domain of ef-ts from t. thermophilus
PDB Compounds: (A:) elongation factor ts

SCOPe Domain Sequences for d1tfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfea_ d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus [TaxId: 274]}
aregiighyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeip
aeelekerqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliq
qaiakigenivvrrfcrfelga

SCOPe Domain Coordinates for d1tfea_:

Click to download the PDB-style file with coordinates for d1tfea_.
(The format of our PDB-style files is described here.)

Timeline for d1tfea_: