Lineage for d5r2fa_ (5r2f A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2410318Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2411713Protein automated matches [190156] (5 species)
    not a true protein
  7. 2411716Species Cryphonectria parasitica [TaxId:5116] [187236] (191 PDB entries)
  8. 2411865Domain d5r2fa_: 5r2f A: [386797]
    automated match to d1oewa_

Details for d5r2fa_

PDB Entry: 5r2f (more details), 1.12 Å

PDB Description: pandda analysis group deposition -- auto-refined data of endothiapepsin for ground state model 02, dmso-free
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d5r2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5r2fa_ b.50.1.2 (A:) automated matches {Cryphonectria parasitica [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d5r2fa_:

Click to download the PDB-style file with coordinates for d5r2fa_.
(The format of our PDB-style files is described here.)

Timeline for d5r2fa_: