SCOP 1.67: Domain d1efub2: 1efu B:140-282

Lineage for d1efub2 (1efu B:140-282)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.43: Elongation factor Ts (EF-Ts), dimerisation domain [54712] (1 superfamily)
   beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123

4. Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family)

5. Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)

6. Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (2 species)

7. Species Escherichia coli [TaxId:562] [54716] (1 PDB entry)
   duplication: consists of two subdomains of this fold

8. Domain d1efub2: 1efu B:140-282 [38677]
   Other proteins in same PDB: d1efua1, d1efua2, d1efua3, d1efub3, d1efuc1, d1efuc2, d1efuc3, d1efud3

Details for d1efub2

PDB Entry: 1efu, 2.5 Å

PDB Description: elongation factor complex ef-tu/ef-ts from escherichia coli

SCOP Domain Sequences for d1efub2:

Sequence; same for both SEQRES and ATOM records:

>d1efub2 d.43.1.1 (B:140-282) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli}
dvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikpedvsaevvekeyqvqld
iamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvgqllkehnaevtgfirfe
vgegiekvetdfaaevaamskqs

Timeline for d1efub2:

• d1efub2 first appeared (with stable ids) in SCOP 1.55
  
• d1efub2 appears in SCOP 1.65
  
• d1efub2 appears in SCOP 1.69
  
• d1efub2 appears in the current release, SCOPe 2.08