| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
| Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54711] (9 PDB entries) |
| Domain d1fqvp2: 1fqv P:2-68 [38673] Other proteins in same PDB: d1fqva1, d1fqva2, d1fqvb1, d1fqvc1, d1fqvc2, d1fqvd1, d1fqve1, d1fqve2, d1fqvf1, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvo1, d1fqvo2, d1fqvp1 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1fqv (more details), 2.8 Å
SCOPe Domain Sequences for d1fqvp2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqvp2 d.42.1.1 (P:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
d
Timeline for d1fqvp2:
View in 3DDomains from other chains: (mouse over for more information) d1fqva1, d1fqva2, d1fqvb1, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd1, d1fqvd2, d1fqve1, d1fqve2, d1fqvf1, d1fqvf2, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvo2 |