SCOPe 2.01: Domain d1fs1d2: 1fs1 D:2-68

Lineage for d1fs1d2 (1fs1 D:2-68)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)

6. Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54711] (8 PDB entries)

8. Domain d1fs1d2: 1fs1 D:2-68 [38665]
   Other proteins in same PDB: d1fs1a1, d1fs1b1, d1fs1c1, d1fs1d1

Details for d1fs1d2

PDB Entry: 1fs1, 1.8 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

PDB Compounds: (D:) cyclin a/cdk2-associated p45

SCOPe Domain Sequences for d1fs1d2:

Sequence; same for both SEQRES and ATOM records:

>d1fs1d2 d.42.1.1 (D:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
d

Timeline for d1fs1d2:

• d1fs1d2 first appeared (with stable ids) in SCOP 1.55
  
• d1fs1d2 appears in SCOP 1.75
  
• d1fs1d2 appears in SCOPe 2.02
  
• d1fs1d2 appears in the current release, SCOPe 2.08