Lineage for d1fs1d2 (1fs1 D:2-68)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502928Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 502929Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 502930Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 502942Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)
  7. 502943Species Human (Homo sapiens) [TaxId:9606] [54711] (5 PDB entries)
  8. 502945Domain d1fs1d2: 1fs1 D:2-68 [38665]
    Other proteins in same PDB: d1fs1a1, d1fs1b1, d1fs1c1, d1fs1d1

Details for d1fs1d2

PDB Entry: 1fs1 (more details), 1.8 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs1d2 d.42.1.1 (D:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens)}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
d

SCOP Domain Coordinates for d1fs1d2:

Click to download the PDB-style file with coordinates for d1fs1d2.
(The format of our PDB-style files is described here.)

Timeline for d1fs1d2: