Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54711] (8 PDB entries) |
Domain d1fs1b2: 1fs1 B:2-68 [38664] Other proteins in same PDB: d1fs1a1, d1fs1b1, d1fs1c1, d1fs1d1 |
PDB Entry: 1fs1 (more details), 1.8 Å
SCOPe Domain Sequences for d1fs1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd d
Timeline for d1fs1b2:
View in 3D Domains from other chains: (mouse over for more information) d1fs1a1, d1fs1c1, d1fs1d1, d1fs1d2 |