Lineage for d5qcoc_ (5qco C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. Protein beta-secretase (memapsin) [50671] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [50672] (329 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. Domain d5qcoc_: 5qco C: [386598]
    automated match to d3kmxa_
    complexed with e4a

Details for d5qcoc_

PDB Entry: 5qco (more details), 2.7 Å

PDB Description: crystal structure of bace complex with bmc016
PDB Compounds: (C:) Beta-secretase 1

SCOPe Domain Sequences for d5qcoc_:

Sequence, based on SEQRES records: (download)

>d5qcoc_ b.50.1.2 (C:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
sfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqls
styrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnweg
ilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiig
gidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlp
kkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfr
itilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavs
achvhdefrtaavegpfvtldmedcgyn

Sequence, based on observed residues (ATOM records): (download)

>d5qcoc_ b.50.1.2 (C:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
sfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqls
styrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnweg
ilglayaeiarpddslepffdslvkqthvpnlfslqlcgaasvggsmiiggidhslytgs
lwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavks
ikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylr
pvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrt
aavegpfvtldmedcgyn

SCOPe Domain Coordinates for d5qcoc_ are not available.

Timeline for d5qcoc_:

Domains from other chains:
(mouse over for more information)
d5qcoa_, d5qcob_