Lineage for d1qdwb_ (1qdw B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513512Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 protein domains)
  6. 2513519Protein Kv1.2 [54708] (1 species)
  7. 2513520Species Norway rat (Rattus norvegicus) [TaxId:10116] [54709] (3 PDB entries)
  8. 2513534Domain d1qdwb_: 1qdw B: [38657]

Details for d1qdwb_

PDB Entry: 1qdw (more details), 2.1 Å

PDB Description: n-terminal domain, voltage-gated potassium channel kv1.2 residues 33-119
PDB Compounds: (B:) kv1.2 voltage-gated potassium channel

SCOPe Domain Sequences for d1qdwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qdwb_ d.42.1.2 (B:) Kv1.2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
qsggrlrrpvnvpldifseeirfyelg

SCOPe Domain Coordinates for d1qdwb_:

Click to download the PDB-style file with coordinates for d1qdwb_.
(The format of our PDB-style files is described here.)

Timeline for d1qdwb_: