Lineage for d5r1pb1 (5r1p B:1-152)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.182: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345889] (1 superfamily)
    10-stranded mixed beta sandwich with 3 helices surrounding the upper rim
  4. Superfamily b.182.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345922] (1 family) (S)
    N-terminal part of Pfam PF05282
  5. Family b.182.1.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345967] (2 proteins)
  6. Protein U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain [346065] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346269] (140 PDB entries)
  8. Domain d5r1pb1: 5r1p B:1-152 [386537]
    Other proteins in same PDB: d5r1pa1, d5r1pa2, d5r1pb2
    automated match to d3sbtb1

Details for d5r1pb1

PDB Entry: 5r1p (more details), 1.95 Å

PDB Description: pandda analysis group deposition -- auto-refined data of aar2/rnaseh for ground state model 40, dmso-free
PDB Compounds: (B:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d5r1pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5r1pb1 b.182.1.1 (B:1-152) U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywf
dcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltef
vqmdkirkivrkdenqfsyvdssmttvqenel

SCOPe Domain Coordinates for d5r1pb1 are not available.

Timeline for d5r1pb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5r1pb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5r1pa1, d5r1pa2