SCOP 1.65: Domain d1qdvb_: 1qdv B:

Lineage for d1qdvb_ (1qdv B:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (2 families)

5. Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins)

6. Protein Kv1.2 [54708] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [54709] (3 PDB entries)

8. Domain d1qdvb_: 1qdv B: [38653]

Details for d1qdvb_

PDB Entry: 1qdv, 1.6 Å

PDB Description: n-terminal domain, voltage-gated potassium channel kv1.2 residues 33-131

SCOP Domain Sequences for d1qdvb_:

Sequence; same for both SEQRES and ATOM records:

>d1qdvb_ d.42.1.2 (B:) Kv1.2 {Rat (Rattus norvegicus)}
ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
qsggrlrrpvnvpldifseeirfyelgeeamemfredeg

Timeline for d1qdvb_:

• d1qdvb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qdvb_ appears in SCOP 1.63
  
• d1qdvb_ appears in SCOP 1.67
  
• d1qdvb_ appears in the current release, SCOPe 2.08