Lineage for d1qdvb_ (1qdv B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328004Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 328005Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 328041Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins)
  6. 328048Protein Kv1.2 [54708] (1 species)
  7. 328049Species Rat (Rattus norvegicus) [TaxId:10116] [54709] (3 PDB entries)
  8. 328059Domain d1qdvb_: 1qdv B: [38653]

Details for d1qdvb_

PDB Entry: 1qdv (more details), 1.6 Å

PDB Description: n-terminal domain, voltage-gated potassium channel kv1.2 residues 33-131

SCOP Domain Sequences for d1qdvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qdvb_ d.42.1.2 (B:) Kv1.2 {Rat (Rattus norvegicus)}
ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
qsggrlrrpvnvpldifseeirfyelgeeamemfredeg

SCOP Domain Coordinates for d1qdvb_:

Click to download the PDB-style file with coordinates for d1qdvb_.
(The format of our PDB-style files is described here.)

Timeline for d1qdvb_: