| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (2 families) ![]() |
| Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins) |
| Protein Kv1.2 [54708] (1 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [54709] (3 PDB entries) |
| Domain d1dsxh_: 1dsx H: [38651] mutant |
PDB Entry: 1dsx (more details), 1.6 Å
SCOP Domain Sequences for d1dsxh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dsxh_ d.42.1.2 (H:) Kv1.2 {Rat (Rattus norvegicus)}
ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
qsggrlrrpvnvpldifseeirfyelg
Timeline for d1dsxh_: