![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (31 species) not a true protein |
![]() | Species Myroides odoratimimus [TaxId:76832] [386292] (1 PDB entry) |
![]() | Domain d6t5lb_: 6t5l B: [386437] automated match to d2bmia_ complexed with mg, zn |
PDB Entry: 6t5l (more details), 2.17 Å
SCOPe Domain Sequences for d6t5lb_:
Sequence, based on SEQRES records: (download)
>d6t5lb_ d.157.1.0 (B:) automated matches {Myroides odoratimimus [TaxId: 76832]} ivyqtenliinklsnhiyehisflntddfgkvacngmlvlnenkvvvfdtptddksslel infvtntlkseiiglipthfhddciggitefenhniqtyvsketiellkdngqefsnptk dfdnsltldignkkvyaeyfgeghtkdnvvgyfpednavfggclikeidaskgylgdani kewsttvekvklkypnakivipghgkwggielfdytiklfe
>d6t5lb_ d.157.1.0 (B:) automated matches {Myroides odoratimimus [TaxId: 76832]} ivyqtenliinklsnhiyehisflvacngmlvlnenkvvvfdtptddkssnfvtntleii glipthfhddciggitefenhniqtyvsketiellkdngqefsnptkdfdnsltldignk kvyaeyfgeghtkdnvvgyfpednavfggclikeidaskgylgdanikewsttvekvklk ypnakivipghgkwggielfdytiklfe
Timeline for d6t5lb_: