Lineage for d6t5lb_ (6t5l B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2997925Species Myroides odoratimimus [TaxId:76832] [386292] (1 PDB entry)
  8. 2997927Domain d6t5lb_: 6t5l B: [386437]
    automated match to d2bmia_
    complexed with mg, zn

Details for d6t5lb_

PDB Entry: 6t5l (more details), 2.17 Å

PDB Description: myo-1 from myroides odoratimimus. environmental metallo-beta- lactamases exhibit high enzymatic activity under zinc deprivation
PDB Compounds: (B:) Subclass B1 metallo-beta-lactamase

SCOPe Domain Sequences for d6t5lb_:

Sequence, based on SEQRES records: (download)

>d6t5lb_ d.157.1.0 (B:) automated matches {Myroides odoratimimus [TaxId: 76832]}
ivyqtenliinklsnhiyehisflntddfgkvacngmlvlnenkvvvfdtptddksslel
infvtntlkseiiglipthfhddciggitefenhniqtyvsketiellkdngqefsnptk
dfdnsltldignkkvyaeyfgeghtkdnvvgyfpednavfggclikeidaskgylgdani
kewsttvekvklkypnakivipghgkwggielfdytiklfe

Sequence, based on observed residues (ATOM records): (download)

>d6t5lb_ d.157.1.0 (B:) automated matches {Myroides odoratimimus [TaxId: 76832]}
ivyqtenliinklsnhiyehisflvacngmlvlnenkvvvfdtptddkssnfvtntleii
glipthfhddciggitefenhniqtyvsketiellkdngqefsnptkdfdnsltldignk
kvyaeyfgeghtkdnvvgyfpednavfggclikeidaskgylgdanikewsttvekvklk
ypnakivipghgkwggielfdytiklfe

SCOPe Domain Coordinates for d6t5lb_:

Click to download the PDB-style file with coordinates for d6t5lb_.
(The format of our PDB-style files is described here.)

Timeline for d6t5lb_: