Lineage for d6z1ya_ (6z1y A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000147Protein automated matches [190420] (9 species)
    not a true protein
  7. 3000325Species Trichosanthes sp. [TaxId:118182] [385268] (2 PDB entries)
  8. 3000326Domain d6z1ya_: 6z1y A: [386433]
    automated match to d1gisa_
    complexed with na

Details for d6z1ya_

PDB Entry: 6z1y (more details), 2 Å

PDB Description: crystal structure of type-i ribosome-inactivating protein trichobakin (tbk)
PDB Compounds: (A:) Trichobakin

SCOPe Domain Sequences for d6z1ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z1ya_ d.165.1.1 (A:) automated matches {Trichosanthes sp. [TaxId: 118182]}
mdvsfrlsgatsssygvfisnlrkalpyerklydipllrstlpgsqryalihltnyadet
isvaidvtnvyvmgyragdtsyffneasateaakyvfkdakrkvtlpysgnyerlqiaag
kireniplglpaldsaittlfyynansaasalmvliqstseaarykfieqqigkrvdktf
lpslaiislenswsalskqiqiastnngqfetpvvlinaqnqrvtitnvdagvvtsnial
lpnr

SCOPe Domain Coordinates for d6z1ya_:

Click to download the PDB-style file with coordinates for d6z1ya_.
(The format of our PDB-style files is described here.)

Timeline for d6z1ya_: