Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein automated matches [190420] (9 species) not a true protein |
Species Trichosanthes sp. [TaxId:118182] [385268] (2 PDB entries) |
Domain d6z1ya_: 6z1y A: [386433] automated match to d1gisa_ complexed with na |
PDB Entry: 6z1y (more details), 2 Å
SCOPe Domain Sequences for d6z1ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z1ya_ d.165.1.1 (A:) automated matches {Trichosanthes sp. [TaxId: 118182]} mdvsfrlsgatsssygvfisnlrkalpyerklydipllrstlpgsqryalihltnyadet isvaidvtnvyvmgyragdtsyffneasateaakyvfkdakrkvtlpysgnyerlqiaag kireniplglpaldsaittlfyynansaasalmvliqstseaarykfieqqigkrvdktf lpslaiislenswsalskqiqiastnngqfetpvvlinaqnqrvtitnvdagvvtsnial lpnr
Timeline for d6z1ya_: