SCOPe 2.08: Domain d6wy4b_: 6wy4 B:

Lineage for d6wy4b_ (6wy4 B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Clostridioides difficile [TaxId:272563] [386392] (1 PDB entry)

8. Domain d6wy4b_: 6wy4 B: [386432]
   Other proteins in same PDB: d6wy4c2, d6wy4d2
   automated match to d3isga_
   complexed with kcx, na, peg

Details for d6wy4b_

PDB Entry: 6wy4, 1.8 Å

PDB Description: crystal structure of wild type class d beta-lactamase from clostridium difficile 630

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6wy4b_:

Sequence; same for both SEQRES and ATOM records:

>d6wy4b_ e.3.1.0 (B:) automated matches {Clostridioides difficile [TaxId: 272563]}
vdysdcfegisggaifyntknkeyniynkelietrrspcstfkivstliglekgvinske
svmgydgteypnknwnknlsleeafkescvwyykklidkvdaksvqnilddlkygncdis
ewegdlkngkghlngfwlesslqispkeqvqtmakifegdtnfkkehinilrdimkidvn
dkninvygktgtgfdeknkrvdawfvgmleregdtyyfaiksddsnkeitgpkvkeiain
iikkyysv

Timeline for d6wy4b_:

• d6wy4b_ first appeared in SCOPe 2.07