Lineage for d1exbe_ (1exb E:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256353Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 256354Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 256370Family d.42.1.2: Tetramerization domain of potassium channels [54701] (6 proteins)
  6. 256393Protein KV1.1 [54706] (1 species)
  7. 256394Species Rat (Rattus norvegicus) [TaxId:10116] [54707] (1 PDB entry)
  8. 256395Domain d1exbe_: 1exb E: [38643]
    Other proteins in same PDB: d1exba_
    complexed with ndp

Details for d1exbe_

PDB Entry: 1exb (more details), 2.1 Å

PDB Description: structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels

SCOP Domain Sequences for d1exbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exbe_ d.42.1.2 (E:) KV1.1 {Rat (Rattus norvegicus)}
cervvinisglrfetqlktlaqfpntllgnpkkrmryfdplrneyffdrnrpsfdailyy
yqsggrlrrpvnvpldmfseeikfyelgeea

SCOP Domain Coordinates for d1exbe_:

Click to download the PDB-style file with coordinates for d1exbe_.
(The format of our PDB-style files is described here.)

Timeline for d1exbe_:

256395
d1exbe_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1exba_