Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) |
Superfamily d.42.1: POZ domain [54695] (2 families) |
Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins) |
Protein KV1.1 [54706] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [54707] (1 PDB entry) |
Domain d1exbe_: 1exb E: [38643] Other proteins in same PDB: d1exba_ |
PDB Entry: 1exb (more details), 2.1 Å
SCOP Domain Sequences for d1exbe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exbe_ d.42.1.2 (E:) KV1.1 {Rat (Rattus norvegicus)} cervvinisglrfetqlktlaqfpntllgnpkkrmryfdplrneyffdrnrpsfdailyy yqsggrlrrpvnvpldmfseeikfyelgeea
Timeline for d1exbe_: