Lineage for d3kvt__ (3kvt -)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328004Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 328005Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 328041Family d.42.1.2: Tetramerization domain of potassium channels [54701] (5 proteins)
  6. 328042Protein akv3.1 voltage-gated potassium channel [54704] (1 species)
  7. 328043Species California sea hare (Aplysia californica) [TaxId:6500] [54705] (1 PDB entry)
  8. 328044Domain d3kvt__: 3kvt - [38642]
    complexed with zn; mutant

Details for d3kvt__

PDB Entry: 3kvt (more details), 2 Å

PDB Description: tetramerization domain from akv3.1 (shaw-subfamily) voltage-gated potassium channel

SCOP Domain Sequences for d3kvt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kvt__ d.42.1.2 (-) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica)}
enrviinvggirhetykatlkkipatrlsrltegmlnydpvlneyffdrhpgvfaqiiny
yrsgklhyptdvcgplfeeelefwgldsnqvepccwmtytahr

SCOP Domain Coordinates for d3kvt__:

Click to download the PDB-style file with coordinates for d3kvt__.
(The format of our PDB-style files is described here.)

Timeline for d3kvt__: