SCOP 1.63: Domain d3kvt__: 3kvt -

Lineage for d3kvt__ (3kvt -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (2 families)

5. Family d.42.1.2: Tetramerization domain of potassium channels [54701] (6 proteins)

6. Protein akv3.1 voltage-gated potassium channel [54704] (1 species)

7. Species California sea hare (Aplysia californica) [TaxId:6500] [54705] (1 PDB entry)

8. Domain d3kvt__: 3kvt - [38642]
   complexed with zn; mutant

Details for d3kvt__

PDB Entry: 3kvt, 2 Å

PDB Description: tetramerization domain from akv3.1 (shaw-subfamily) voltage-gated potassium channel

SCOP Domain Sequences for d3kvt__:

Sequence; same for both SEQRES and ATOM records:

>d3kvt__ d.42.1.2 (-) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica)}
enrviinvggirhetykatlkkipatrlsrltegmlnydpvlneyffdrhpgvfaqiiny
yrsgklhyptdvcgplfeeelefwgldsnqvepccwmtytahr

Timeline for d3kvt__:

• d3kvt__ first appeared (with stable ids) in SCOP 1.55
  
• d3kvt__ appears in SCOP 1.61
  
• d3kvt__ appears in SCOP 1.65
  
• d3kvt__ appears in the current release, SCOPe 2.08, called d3kvta_