Lineage for d1eoda_ (1eod A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256353Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 256354Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 256370Family d.42.1.2: Tetramerization domain of potassium channels [54701] (6 proteins)
  6. 256418Protein Shaker potassium channel [54702] (1 species)
  7. 256419Species California sea hare (Aplysia californica) [TaxId:6500] [54703] (5 PDB entries)
  8. 256424Domain d1eoda_: 1eod A: [38641]
    mutant

Details for d1eoda_

PDB Entry: 1eod (more details), 2.45 Å

PDB Description: crystal structure of the n136d mutant of a shaker t1 domain

SCOP Domain Sequences for d1eoda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eoda_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica)}
ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
qsggrlrrpvdvpldvfseeikfyelgenaferyredegf

SCOP Domain Coordinates for d1eoda_:

Click to download the PDB-style file with coordinates for d1eoda_.
(The format of our PDB-style files is described here.)

Timeline for d1eoda_: